PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G251700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 182aa    MW: 20285.7 Da    PI: 7.6282
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G251700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1383.7e-1282137358
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                         + +r rr+ +NRe+ArrsR RK+ ++ eL   v  L + N++L + l++    ++ 
  Sevir.2G251700.1.p  82 DERRRRRMVSNRESARRSRMRKQRQLTELWAQVVHLRGANRRLLDDLNQAMRGCSD 137
                         5679999*************************************999998777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.1E-978133No hitNo description
SMARTSM003382.0E-1380144IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.89882133IPR004827Basic-leucine zipper domain
PfamPF001701.0E-984138IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.72E-1084133No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
CDDcd147021.91E-1389133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MLQQHHYHGA VAMANLHCLS SPNPAFHAHC HSNMIAMPPT PFHFSPSTFE PIHEAPAVVS  60
NSPAGSGSAE DAYGGRMVMA EDERRRRRMV SNRESARRSR MRKQRQLTEL WAQVVHLRGA  120
NRRLLDDLNQ AMRGCSDMCC ENAQLEKEKA ELSTKLERLM QAQSTTTPSS SSEPQDDTST  180
E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196103RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957101.11e-134PREDICTED: basic leucine zipper 43-like
TrEMBLK3ZXA61e-134K3ZXA6_SETIT; Uncharacterized protein
STRINGSi031238m1e-133(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.13e-11basic leucine-zipper 42